DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab2b

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001005636.1 Gene:rab2b / 448102 XenbaseID:XB-GENE-920598 Length:215 Species:Xenopus tropicalis


Alignment Length:211 Identity:80/211 - (37%)
Similarity:123/211 - (58%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSL 94
            ||.:::|::.||||.|:|:|...:|....:.|||..|..:.|.|:...:|.:||||||||.:.|:
 Frog     7 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKPIKLQIWDTAGQESFRSI 71

  Fly    95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159
            ...|||||..|::||||..:::|....:|:::..:.:|.|:||.|.|||:||.:.|.|..:|.:.
 Frog    72 TRSYYRGAAGALLVYDITRRETFSHLTSWLEDARQHSSSNMVIILIGNKSDLESRRDVSREEGEA 136

  Fly   160 YAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK---------NDGANNQGTSIRP---------T 206
            :|.|:||:||||||||..||.:.|:..||::.|         |:.||  |..:.|         :
 Frog   137 FAREHGLIFMETSAKTAANVEEAFIDTAKEIYKKIQQGLFDVNNEAN--GIKVGPQQSINEPLGS 199

  Fly   207 GTETNR----PTNNCC 218
            |...|:    .|:.||
 Frog   200 GLRQNQNEGGGTSGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 69/160 (43%)
rab2bNP_001005636.1 PLN03108 1..215 CDD:178655 78/209 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.