DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and CG8500

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster


Alignment Length:175 Identity:60/175 - (34%)
Similarity:90/175 - (51%) Gaps:7/175 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TAQRPNGT--SQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTV 77
            |.|:...|  :..:|..:::|:.|...||||||||||:||.|.|....||...: .|.|.....:
  Fly     2 TEQKNQVTRAAPEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTY-RQVISCNKNI 65

  Fly    78 VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAK-TW--VKELHKQASPNIVIAL 139
            ...:|.||.|..::.::..:......|.|:||.:.::.|.:..: .|  :|||.....|||.:.|
  Fly    66 CTLQITDTTGSHQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVML 130

  Fly   140 AGNKAD-LSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIF 183
            .|||.| .:.:|.|...|.:..|....:.||||||||..||.::|
  Fly   131 VGNKCDETAELREVSQAEGQAQATTWSISFMETSAKTNHNVTELF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 56/159 (35%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 56/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.