DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab23

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:223 Identity:72/223 - (32%)
Similarity:114/223 - (51%) Gaps:20/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SGGASG----TGTAQRPNGTSQNK---SCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA 64
            :|||:.    |.:..:.|.||..:   ....|:|::|...|||||::.|:.||.|.:..:.|||.
  Fly     8 TGGAAASVLQTHSQAQYNYTSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGV 72

  Fly    65 AFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHK 129
            .||.:.|.|:...|:..:|||||||.:..:...|||||||:::|:...::.||...|.|.:::..
  Fly    73 DFLERQIEIDGEDVRIMLWDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVEN 137

  Fly   130 QAS--PNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK 192
            :.:  |.:::.   ||.||....||..||.:..|:......:.||.|..:||..:|..:|.|..:
  Fly   138 ECNEIPTVIVQ---NKIDLIEQAVVTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQ 199

  Fly   193 ------NDGANNQGTSIRPTGTETNRPT 214
                  :..|.||..|..|..:.|  ||
  Fly   200 LMTQSYDQVAGNQQNSSHPPYSST--PT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 57/163 (35%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 52/151 (34%)
Rab23_like 50..197 CDD:133306 51/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.