DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab5b

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_998050.1 Gene:rab5b / 405821 ZFINID:ZDB-GENE-040426-2593 Length:214 Species:Danio rerio


Alignment Length:214 Identity:144/214 - (67%)
Similarity:174/214 - (81%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GTGTAQRPNGT-SQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIED 75
            |||   |.||. .|.|.|||||||||:.||||||||||||||||.|:||:|||||||.|::|::|
Zfish     5 GTG---RANGNLPQTKICQFKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDD 66

  Fly    76 TVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALA 140
            |.|||||||||||||||||||||||||||||||:||...::|:|||.|||||.:|||||||||||
Zfish    67 TTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFERAKAWVKELQRQASPNIVIALA 131

  Fly   141 GNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND------GANNQ 199
            ||||||::.|:||::||:.|||:.|||||||||||.||||::|||||||:||.|      .|.::
Zfish   132 GNKADLADKRLVEYEEAQTYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKTDTQNPTHAARHR 196

  Fly   200 GTSIRPTGTETNRPTNNCC 218
            |.:::....::   |.:||
Zfish   197 GVNLQDPDAQS---TRSCC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 127/161 (79%)
rab5bNP_998050.1 Rab5_related 20..182 CDD:206653 127/161 (79%)
Ras 22..183 CDD:278499 125/160 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.