DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and KRAS

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001356715.1 Gene:KRAS / 3845 HGNCID:6407 Length:189 Species:Homo sapiens


Alignment Length:163 Identity:51/163 - (31%)
Similarity:92/163 - (56%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            ::|||::|...||||:|.::.::..|.:..:.||..::..|.: |:......:|.||||||.|.:
Human     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDILDTAGQEEYSA 66

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHK-QASPNIVIALAGNKADLSNIRVVEFDEA 157
            :...|.|..:..:.|:.|.|..||:....:.:::.: :.|.::.:.|.|||.||.: |.|:..:|
Human    67 MRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPS-RTVDTKQA 130

  Fly   158 KQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL 190
            :..|...|:.|:||||||...|.|.|..:.:::
Human   131 QDLARSYGIPFIETSAKTRQRVEDAFYTLVREI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 51/163 (31%)
KRASNP_001356715.1 H_N_K_Ras_like 3..164 CDD:133338 51/163 (31%)
Effector region 32..40 2/7 (29%)
Hypervariable region 166..185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.