DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RabX6

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:206 Identity:57/206 - (27%)
Similarity:97/206 - (47%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQF--HEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            |::|.|:..||||||..||....|  ...::||:|...:.:...:.:..:|.::|||.|.||..|
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIR-VVEFDEA 157
            :...||:.|:.||:|:.:.|..||......:.::...|. |..|.:.|||:||.... .|..:|.
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138

  Fly   158 KQYAEENGLLF---METSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIR------------PTG 207
            :.:.|:...|.   .:||.::|..|.::|..|:::|..   ||.....::            .:|
  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVH---ANRSKMELQALEHKSFQVDTASSG 200

  Fly   208 TETNRPTNNCC 218
            ..||....:.|
  Fly   201 AATNEEDASSC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 50/165 (30%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 51/166 (31%)
Rab 10..172 CDD:206640 50/162 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.