DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rap2l

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster


Alignment Length:195 Identity:62/195 - (31%)
Similarity:94/195 - (48%) Gaps:24/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            :||:|:||...||||:|.::||.|.|.|..:.|| ..|..:.|.::.:....||.||||.|::.|
  Fly     3 EFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTI-EDFYRKEIEVDSSPCVLEILDTAGTEQFAS 66

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHK----QASPNIVIALAGNKADLSNIRVVEF 154
            :..:|.:.....||:|.:.|..:||...:....:.:    |.:|   |.|..||.||...|.|..
  Fly    67 MRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAP---ILLVANKFDLDCQREVST 128

  Fly   155 DEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTETNRPTNN-CC 218
            .|....|:.....|:|.|||..:|||::|..|.:::               ..|:.||...| ||
  Fly   129 AEGNALAQLWDCPFIEASAKDRINVNEVFATIVREM---------------NLTQENRQKKNYCC 178

  Fly   219  218
              Fly   179  178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 56/165 (34%)
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 49/167 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.