DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab9b

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001102488.1 Gene:Rab9b / 367915 RGDID:1562951 Length:201 Species:Rattus norvegicus


Alignment Length:217 Identity:70/217 - (32%)
Similarity:106/217 - (48%) Gaps:43/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQER 90
            ||...|::|||:..||||||:.|:|..:|......|||..||.:.:.::...|..:|||||||||
  Rat     4 KSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQER 68

  Fly    91 YHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQAS-------PNIVIALAGNKADLSN 148
            :.||...:||||...::.:.:.::.||:....|.||....|.       |.:|:   |||.|..:
  Rat    69 FKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVL---GNKVDKED 130

  Fly   149 IRVVEFDEAKQYAEENG-LLFMETSAKTGMNVNDIF-------LAIAKKLPK---------NDGA 196
             |.|..:||:.:..||| ..::|||||...||...|       ||:.::|..         |.| 
  Rat   131 -RQVTTEEAQAWCMENGNYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSG- 193

  Fly   197 NNQGTSIRPTGTETNRPTNNCC 218
                          ::.:::||
  Rat   194 --------------SKASSSCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 63/176 (36%)
Rab9bNP_001102488.1 Rab9 3..172 CDD:206697 63/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.