DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab22a

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_006235767.1 Gene:Rab22a / 366265 RGDID:1311959 Length:194 Species:Rattus norvegicus


Alignment Length:193 Identity:87/193 - (45%)
Similarity:133/193 - (68%) Gaps:6/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            :.|:.|||::.|||||:|.|||:..|......||||:|:|:|:..::.:.||.|||||||||:.:
  Rat     5 ELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRA 69

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAK 158
            ||||||||:.|||:||||..:::|...|.||:||.:...|:||:|:||||.||:::|.|...:||
  Rat    70 LAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERDAK 134

  Fly   159 QYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND---GANNQGTSIRPTGTETNRPTNNCC 218
            .||:....:|:|||||..:|:|::|:.|:::||..|   .:..:|..:|   .:.:.|..:||
  Rat   135 DYADSIHAIFVETSAKNAININELFIEISRRLPSTDASPASGGKGFKLR---RQPSEPKRSCC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 79/161 (49%)
Rab22aXP_006235767.1 Rab5_related 5..167 CDD:206653 79/161 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.