DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rabl2

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_006242287.1 Gene:Rabl2 / 362987 RGDID:1306749 Length:250 Species:Rattus norvegicus


Alignment Length:171 Identity:60/171 - (35%)
Similarity:90/171 - (52%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
            |::.||:||||||.|:.||:...|...|.||........|..::...:..:.||||||||:.|:.
  Rat    50 KIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMH 114

  Fly    96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVE--FDEAK 158
            ..||..|.|.|:|:|:|.:.:::...||..|| ::..|.|...|..||.| ::|::.:  |..||
  Rat   115 ASYYHKAHACIMVFDVQRKITYKNLGTWYAEL-REFRPEIPCILVANKID-ADIQMTQKNFSFAK 177

  Fly   159 QYAEENGLLFMETSAKTGMNVNDIF-----LAIAKKLPKND 194
            :::    |.....||..|.||..:|     ||:|.|....|
  Rat   178 KFS----LPLYFVSAADGTNVVKLFNDAIRLAVAYKKSSQD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 59/166 (36%)
Rabl2XP_006242287.1 RabL2 49..209 CDD:133324 58/164 (35%)
RAB 49..198 CDD:197555 54/153 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.