DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab5aa

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_958893.1 Gene:rab5aa / 337737 ZFINID:ZDB-GENE-030131-139 Length:216 Species:Danio rerio


Alignment Length:211 Identity:158/211 - (74%)
Similarity:180/211 - (85%) Gaps:7/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTAQRPNGTSQ-NKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTV 77
            |.|.||||::. ||.|||||||||||||||||||||||||||||:|||||||||||||:|::||.
Zfish     5 GGATRPNGSNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTT 69

  Fly    78 VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGN 142
            ||||||||||||||||||||||||||||||||||.|::||.|||.|||||.:||||||||||:||
Zfish    70 VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGN 134

  Fly   143 KADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND----GANNQGTSI 203
            ||||:|.|.|:|.:|:.||::|.||||||||||.||||:||:||||||||::    |||: |.|.
Zfish   135 KADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGANS-GRSR 198

  Fly   204 RPTGTETNRPTN-NCC 218
            ....|||.:||. .||
Zfish   199 GVDLTETAQPTKAPCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 134/161 (83%)
rab5aaNP_958893.1 Rab5_related 21..183 CDD:206653 134/161 (83%)
Ras 23..184 CDD:278499 133/160 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 275 1.000 Domainoid score I1717
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm25041
orthoMCL 1 0.900 - - OOG6_100743
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.