DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab21

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:220 Identity:86/220 - (39%)
Similarity:124/220 - (56%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIED-TVVKFEIW 83
            ||.:.|    ||.|||||..|||:|||||:::.:|:....||:.|:|:::.:.:|| ...:..||
  Fly     8 NGPTLN----FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIW 68

  Fly    84 DTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSN 148
            |||||||:|:|.|:||||:..|::||||.::||||:.|:||:||.:.....|.:.:.|||.||..
  Fly    69 DTAGQERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEE 133

  Fly   149 IRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL------------------PKNDG 195
            .|.|..|||.|||...|..::|||||....|.::|..:.:.:                  |..|.
  Fly   134 QRAVTHDEALQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDN 198

  Fly   196 ANNQGTSIRPTGTETNRPT--NNCC 218
            .||...|..|   :...|.  .:||
  Fly   199 LNNSDDSEAP---DPGDPAGQRSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 74/180 (41%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 74/161 (46%)
Ras 15..177 CDD:278499 73/161 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.