DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and AgaP_AGAP007369

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_564861.2 Gene:AgaP_AGAP007369 / 3290360 VectorBaseID:AGAP007369 Length:273 Species:Anopheles gambiae


Alignment Length:234 Identity:46/234 - (19%)
Similarity:96/234 - (41%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SGTGTAQRPNGTSQNKS------------CQ---------------FKLVLLGESAVGKSSLVLR 48
            ||.||:...:.:|.:.:            |:               .::.::|.:.|||||::.:
Mosquito    21 SGVGTSTSSSSSSSSSAAVCTAADDDLFGCEGAVPASPPATVKKERHRVTMMGAARVGKSSIISQ 85

  Fly    49 FVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQN 113
            |:..::....:.||......:....:.:.:..:|.||:|..::.::..:....:.|.|:||.:.:
Mosquito    86 FLYEKYLSRYKQTIEEMHRGEYELPDGSSLTLDILDTSGSYQFPAMRALSINTSGAFILVYAVDD 150

  Fly   114 QDSFQRAKTWVKELHKQASPNIVIALAGNKADL-SNIRVVEFDEAKQYA-EENGLLFMETSAKTG 176
            ::::...:...:::.......:.|.:.|||||: ...|.:.|..|:..| .|.|..:.|.|||..
Mosquito   151 EETWNEVERLREQIISVRGTRVPIVIVGNKADVPEEDRQIPFKVARSRALLEWGCGYAECSAKNN 215

  Fly   177 MNVNDIFLAI-----------------AKKLPKNDGANN 198
            ..:..:|..:                 .|.||...||.|
Mosquito   216 EGILTVFKQLLRQANIEYNLSPAVRRRRKSLPSYTGATN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 35/195 (18%)
AgaP_AGAP007369XP_564861.2 RAS 67..231 CDD:214541 34/163 (21%)
P-loop_NTPase 68..272 CDD:304359 40/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.