DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab39

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster


Alignment Length:211 Identity:79/211 - (37%)
Similarity:121/211 - (57%) Gaps:22/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIED-TVVKFEIWDTAGQERYH 92
            ||:|:|:|:|.||||||:..|..|:|.|..:.|:|..|..:.|.::| |.:|.::||||||||:.
  Fly     9 QFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFR 73

  Fly    93 SLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPN-IVIALAGNKADLSNI---RVVE 153
            |:...|||.:...::||||.|..||:....|:.|..:...|: .|.||.|.|.||.|.   |.|.
  Fly    74 SITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVT 138

  Fly   154 FDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL---------PKNDGAN--NQGTSIRPTG 207
            .:||:::|:::||.|:||||::|.||.:.|..:.:::         ...||.:  ..|.| ||..
  Fly   139 TEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFS-RPNS 202

  Fly   208 TETN----RP-TNNCC 218
            .:.|    .| .::||
  Fly   203 LDFNLVVAEPEKSSCC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 69/175 (39%)
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 77/209 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.