DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab27

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:174 Identity:57/174 - (32%)
Similarity:95/174 - (54%) Gaps:10/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDT----VVKFEIWDTAGQERY 91
            :.::||:|.|||:.|:.::..|:||....||:|..|..:.:.....    .:..:|||||||||:
  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83

  Fly    92 HSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQA---SPNIVIALAGNKADLSNIRVVE 153
            .||...:||.|...::::|:.::.||.....|:.:|...|   .|::|  |.|||.||..:|||.
  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVV--LCGNKCDLLQLRVVS 146

  Fly   154 FDEAKQYAEENGLLFMETSAKTGMNVND-IFLAIAKKLPKNDGA 196
            .|:.........|.::||||.||.||.: :.|.:.:.:.:.:.|
  Fly   147 RDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 56/167 (34%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 56/169 (33%)
RAB 20..186 CDD:197555 56/167 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.