DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab18

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001012486.1 Gene:Rab18 / 307039 RGDID:1308905 Length:206 Species:Rattus norvegicus


Alignment Length:181 Identity:74/181 - (40%)
Similarity:106/181 - (58%) Gaps:7/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
            |::::|||.||||||:|||....|.....:|||..|..:||.::....|..|||||||||:.:|.
  Rat    10 KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLT 74

  Fly    96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPN-IVIALAGNKADLSNIRVVEFDEAKQ 159
            |.||||||..|:|||:..:|:|.:...|:.||....:.| ||..|.|||.|..| |.|:.:|..:
  Rat    75 PSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRNEGLK 138

  Fly   160 YAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGA-----NNQGTSIRP 205
            :|.::.:||:|.||||...|...|..:.:|:.:..|.     .|:|..:.|
  Rat   139 FARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 70/160 (44%)
Rab18NP_001012486.1 RAB 9..172 CDD:197555 70/162 (43%)
Rab18 9..169 CDD:206656 69/159 (43%)
Effector region. /evidence=ECO:0000250 37..45 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.