DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab21

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001004238.1 Gene:Rab21 / 299799 RGDID:1303150 Length:223 Species:Rattus norvegicus


Alignment Length:223 Identity:86/223 - (38%)
Similarity:126/223 - (56%) Gaps:19/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIE 74
            |:|.|.|     .:..::..||:|||||..|||:|||||:.:.:|::...:|:.|:|||:.:.|.
  Rat     3 AAGGGAA-----AAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIG 62

  Fly    75 DTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIAL 139
            ...|...|||||||||:|:|.|:|||.:..||:|||:.::||||:.|.|||||.|.....|.:.:
  Rat    63 GKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCI 127

  Fly   140 AGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL---------PKNDG 195
            .|||.||...|.|...||:.|||..|.....||||....:.::||.:.|::         .|.:|
  Rat   128 VGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNG 192

  Fly   196 ANNQGTSIRPTGTETNRP-----TNNCC 218
            ::..|.:.|......:.|     :..||
  Rat   193 SSQAGAARRGVQIIDDEPQAQSGSGGCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 75/170 (44%)
Rab21NP_001004238.1 Rab21 18..179 CDD:133323 75/160 (47%)
Effector region. /evidence=ECO:0000250 46..54 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.