DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab5c

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001099310.2 Gene:Rab5c / 287709 RGDID:1307095 Length:216 Species:Rattus norvegicus


Alignment Length:213 Identity:159/213 - (74%)
Similarity:177/213 - (83%) Gaps:5/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SGTGTAQRPNG-TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIE 74
            :|.|.|.|||| .:.||.|||||||||||||||||||||||||||||||||||||||||||:|::
  Rat     2 AGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLD 66

  Fly    75 DTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIAL 139
            ||.||||||||||||||||||||||||||||||||||.|.|:|.|||.|||||.:||||||||||
  Rat    67 DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIAL 131

  Fly   140 AGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIR 204
            |||||||::.|.|||.||:.||::|.||||||||||.||||:||:|||||||||:..|..|...|
  Rat   132 AGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGR 196

  Fly   205 PTGT---ETNRPT-NNCC 218
            ..|.   |:|..: :.||
  Rat   197 NRGVDLQESNPASRSQCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 137/161 (85%)
Rab5cNP_001099310.2 Rab5_related 21..183 CDD:206653 137/161 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353271
Domainoid 1 1.000 277 1.000 Domainoid score I1654
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55533
Inparanoid 1 1.050 308 1.000 Inparanoid score I2540
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm45820
orthoMCL 1 0.900 - - OOG6_100743
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X457
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.