DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab6b

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_006511799.1 Gene:Rab6b / 270192 MGIID:107283 Length:234 Species:Mus musculus


Alignment Length:191 Identity:76/191 - (39%)
Similarity:112/191 - (58%) Gaps:17/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATTPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAA 65
            ||.||.|...|....    :.||..|             |||:||:.||:...|....::|||..
Mouse    28 MAATPGSEAFSSAPC----SSTSGAK-------------VGKTSLITRFMYDSFDNTYQATIGID 75

  Fly    66 FLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQ 130
            ||::|:.:||..|:.::||||||||:.||.|.|.|.:..|:|||||.|.:|||:...|:.::..:
Mouse    76 FLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTE 140

  Fly   131 ASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLP 191
            ...:::|.|.|||.||::.|.:..:|.:|.|:|..::|:|||||||.||..:|..:|..||
Mouse   141 RGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 65/161 (40%)
Rab6bXP_006511799.1 Rab6 50..200 CDD:206654 65/149 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.