DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and ryh1

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_593249.1 Gene:ryh1 / 2543529 PomBaseID:SPAC4C5.02c Length:201 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:81/198 - (40%)
Similarity:124/198 - (62%) Gaps:3/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SQNKSC---QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWD 84
            |:|.|.   :||||.|||.:|||:||:.||:..||....::|||..||::|:.:||..|:.::||
pombe     2 SENYSFSLRKFKLVFLGEQSVGKTSLITRFMYDQFDNTYQATIGIDFLSKTMYLEDRTVRLQLWD 66

  Fly    85 TAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNI 149
            ||||||:.||.|.|.|.:..||:||||.|.:||...:.|::::..:...:::|.|.|||.||::.
pombe    67 TAGQERFRSLIPSYIRDSSVAIIVYDITNHNSFVNTEKWIEDVRAERGDDVIIVLVGNKTDLADK 131

  Fly   150 RVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTETNRPT 214
            |.|..:|.::.|:|..::.||||||.|.||..:|..||:.||..:....|.|.:.....:.|...
pombe   132 RQVTQEEGEKKAKELKIMHMETSAKAGHNVKLLFRKIAQMLPGMENVETQSTQMIDVSIQPNENE 196

  Fly   215 NNC 217
            ::|
pombe   197 SSC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 72/161 (45%)
ryh1NP_593249.1 Rab6 12..172 CDD:206654 72/159 (45%)
RAB 12..170 CDD:197555 71/157 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.