DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and ypt5

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001342856.1 Gene:ypt5 / 2542248 PomBaseID:SPAC6F6.15 Length:211 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:123/198 - (62%)
Similarity:144/198 - (72%) Gaps:15/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICI-EDTVVKFEIWDTAGQERYHSL 94
            ||||||:||||||||||||||.||.:|:||||||||||||:.| |:|.||.|||||||||||.||
pombe    16 KLVLLGDSAVGKSSLVLRFVKDQFDDYRESTIGAAFLTQTLPIDENTSVKLEIWDTAGQERYKSL 80

  Fly    95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLS-NIRVVEFDEAK 158
            ||||||.|..|||||||....|.::||:|:|||.:||...|||||||||.||: ..|.||..:|:
pombe    81 APMYYRNANCAIVVYDITQAASLEKAKSWIKELQRQAPEGIVIALAGNKLDLAQERRAVEKADAE 145

  Fly   159 QYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND------GANNQGTSI---RPTGTETNRPT 214
            .||.|..|||.||||||..|||::|.|||||||..|      ||.|:|.::   ||..    :|:
pombe   146 AYAAEANLLFFETSAKTAENVNELFTAIAKKLPLEDKLNQARGAVNRGVNLSEARPAA----QPS 206

  Fly   215 NNC 217
            .:|
pombe   207 GSC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 112/161 (70%)
ypt5NP_001342856.1 Rab5_related 16..178 CDD:206653 112/161 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 207 1.000 Domainoid score I624
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 214 1.000 Inparanoid score I937
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - oto101598
orthoMCL 1 0.900 - - OOG6_100743
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.