DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and ypt3

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001342809.1 Gene:ypt3 / 2542219 PomBaseID:SPAC18G6.03 Length:214 Species:Schizosaccharomyces pombe


Alignment Length:213 Identity:87/213 - (40%)
Similarity:126/213 - (59%) Gaps:22/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CQ-------FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDT 85
            ||       ||.||:|:|.||||:|::||.:.:|:...:||||..|.|:.|.:::..:|.:||||
pombe     2 CQEDEYDYLFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDT 66

  Fly    86 AGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIR 150
            ||||||.::...|||||..|::||||..|.||.....|:|||.:.|..||||.|.|||.||.::|
pombe    67 AGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDLLHLR 131

  Fly   151 VVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK----------NDGAN---NQGTS 202
            .|..:||:.:|.||.|.|:||||....||.:.|..:..::.:          :||.:   .|..:
pombe   132 AVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDGVHPTAGQTLN 196

  Fly   203 IRPTGTETN--RPTNNCC 218
            |.||..:.|  :.::.||
pombe   197 IAPTMNDLNKKKSSSQCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 77/168 (46%)
ypt3NP_001342809.1 Rab11_like 8..172 CDD:206660 76/163 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.