Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036382.2 | Gene: | RRAS2 / 22800 | HGNCID: | 17271 | Length: | 204 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 59/205 - (28%) |
---|---|---|---|
Similarity: | 109/205 - (53%) | Gaps: | 18/205 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWD 84
Fly 85 TAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKEL----HKQASPNIVIALAGNKAD 145
Fly 146 LSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIF---LAIAKKLPKNDGANNQGTSIRPTG 207
Fly 208 TETNRPTNNC 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 51/168 (30%) |
RRAS2 | NP_036382.2 | M_R_Ras_like | 13..176 | CDD:133345 | 51/169 (30%) |
Effector region | 43..51 | 2/7 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |