DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RRAS2

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_036382.2 Gene:RRAS2 / 22800 HGNCID:17271 Length:204 Species:Homo sapiens


Alignment Length:205 Identity:59/205 - (28%)
Similarity:109/205 - (53%) Gaps:18/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWD 84
            :|:.|.|   ::||::|...||||:|.::|::..|....:.||..::..|.: |:|...:.:|.|
Human     8 DGSGQEK---YRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCV-IDDRAARLDILD 68

  Fly    85 TAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKEL----HKQASPNIVIALAGNKAD 145
            |||||.:.::...|.|..:..::|:.:.::.||:....:.:::    .:...|.|:|   |||||
Human    69 TAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILI---GNKAD 130

  Fly   146 LSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIF---LAIAKKLPKNDGANNQGTSIRPTG 207
            |.:.|.|..:|.:|.|.:..:.:||.|||..|||:..|   :.:.:|..:.:..    .|..||.
Human   131 LDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECP----PSPEPTR 191

  Fly   208 TETNRPTNNC 217
            .|.::...:|
Human   192 KEKDKKGCHC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 51/168 (30%)
RRAS2NP_036382.2 M_R_Ras_like 13..176 CDD:133345 51/169 (30%)
Effector region 43..51 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.