DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab24

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_006517228.1 Gene:Rab24 / 19336 MGIID:105065 Length:266 Species:Mus musculus


Alignment Length:164 Identity:74/164 - (45%)
Similarity:106/164 - (64%) Gaps:8/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQF--HEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            |:|:||:..|||:|||.|:|..:|  ..|| :||||||:.:.:|:.|..|...||||||.|||.:
Mouse     9 KVVMLGKEYVGKTSLVERYVHDRFLVGPYQ-NTIGAAFVAKVMCVGDRTVTLGIWDTAGSERYEA 72

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL----SNIRVVEF 154
            ::.:|||||:||||.||:.:..||:|||.||||| :.......|.|.|.|:||    ...|.|:|
Mouse    73 MSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKEL-RSLEEGCQIYLCGTKSDLLEEDRRRRRVDF 136

  Fly   155 DEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAK 188
            .:.:.||:.......|||:|||.:|:::|..:|:
Mouse   137 HDVQDYADNIKAQLFETSSKTGQSVDELFQKVAE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 74/164 (45%)
Rab24XP_006517228.1 Rab24 8..183 CDD:133318 74/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.