Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001153201.1 | Gene: | Rab23 / 19335 | MGIID: | 99833 | Length: | 237 | Species: | Mus musculus |
Alignment Length: | 225 | Identity: | 69/225 - (30%) |
---|---|---|---|
Similarity: | 115/225 - (51%) | Gaps: | 39/225 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
Fly 96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQY 160
Fly 161 AEENGLLFMETSAKTGMNVNDIFLAIAKK---------------------------------LPK 192
Fly 193 NDGANNQG--TSIRPTGTETNR---PTNNC 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 59/192 (31%) |
Rab23 | NP_001153201.1 | Rab23_like | 10..169 | CDD:133306 | 58/158 (37%) |
Effector region. /evidence=ECO:0000250 | 38..46 | 3/7 (43%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..237 | 9/31 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |