DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab-21

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_495854.1 Gene:rab-21 / 187932 WormBaseID:WBGene00004279 Length:207 Species:Caenorhabditis elegans


Alignment Length:199 Identity:81/199 - (40%)
Similarity:118/199 - (59%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQER 90
            ||.:||:|||||..|||||||||||:.:|.....|||.|:|..:|:.:||......||||||||:
 Worm     9 KSFKFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQEK 73

  Fly    91 YHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFD 155
            ||:|.|:||||:...::|:||.::.||::.|.||.|:.........|.:.|||.||...|.|...
 Worm    74 YHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGNTAEILIVGNKIDLEEERQVTRQ 138

  Fly   156 EAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN-----NQGTSIRPTGTETNRPTN 215
            :|:.|||..|.|:|||||:..:.::|.|.::..|:.::....     :...|||....:....:.
 Worm   139 DAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTNRSIRLIDNDEAERSK 203

  Fly   216 NCCK 219
            .||:
 Worm   204 KCCR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 74/161 (46%)
rab-21NP_495854.1 Rab21 13..174 CDD:133323 74/160 (46%)
Ras 14..175 CDD:278499 73/160 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.