DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and drn-1

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001333544.2 Gene:drn-1 / 183765 WormBaseID:WBGene00016911 Length:219 Species:Caenorhabditis elegans


Alignment Length:202 Identity:57/202 - (28%)
Similarity:95/202 - (47%) Gaps:14/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIED 75
            :.|.||...:..::..:..:::.:.|...|||||:..|||||.|:|....||...:.....|.:.
 Worm    12 AATTTAGSGSKVAEASTSDYRVAVFGAGGVGKSSITQRFVKGTFNENYVPTIEDTYRQVISCNQK 76

  Fly    76 TVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIV---- 136
            .|...:|.||.|..::.::..:......|.|::|.:.|:.||..... :.|:.|:...|.:    
 Worm    77 NVCTLQITDTTGSHQFPAMQRLSISKGNAFILIYSVTNKQSFAELVP-IIEMMKEVKGNAIAETP 140

  Fly   137 IALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIF---LAIAKK------LPK 192
            |.|.|||.|..:.|.|..:..::.|......|:|||||...|:.::|   ||:.||      :..
 Worm   141 IMLVGNKKDEESKREVSSNSGQKVATNMECGFIETSAKNNENITELFQQLLALEKKRQLALTMDD 205

  Fly   193 NDGANNQ 199
            .||.|.:
 Worm   206 PDGKNGK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 51/174 (29%)
drn-1NP_001333544.2 P-loop_NTPase 30..195 CDD:328724 49/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.