DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and C52B11.5

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_508236.1 Gene:C52B11.5 / 183717 WormBaseID:WBGene00016874 Length:238 Species:Caenorhabditis elegans


Alignment Length:213 Identity:52/213 - (24%)
Similarity:98/213 - (46%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SQNKSCQF----------------KLVLLGESAVGKSSLVLRFVKGQFHEYQES-----TIGAAF 66
            |||...|.                |::::|....|||:.:.|...|:|||.:::     .|....
 Worm     2 SQNTESQMLVALPADYIPEASRRCKIIVVGAKNAGKSTFIERVEFGKFHEEKQTEKLYRVIAKKV 66

  Fly    67 LTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQA 131
            ..||:.:|  :::.::.....::.......|  |...|.::.|...:.:||::.|..:..:.::.
 Worm    67 FEQTLTVE--LIEKDLGGLTNEDNGFKKTEM--RDVDAVLLFYAADDLESFKQLKENLVHVQRKI 127

  Fly   132 SPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNV----NDIFLAIAKKLPK 192
            .||..|.:.|.|||:..:: |::.|...:||..|....|||:|||:||    :||...|.::...
 Worm   128 PPNANITVVGTKADVKEMQ-VQWQEVDSFAENQGFSCFETSSKTGVNVEIILHDILETIFERRFA 191

  Fly   193 NDGANNQGTSIRPTGTET 210
            :|  :::..|.:|....|
 Worm   192 SD--DDEVLSNQPVYAST 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 45/186 (24%)
C52B11.5NP_508236.1 P-loop_NTPase 25..183 CDD:304359 43/162 (27%)
Ras 26..187 CDD:278499 44/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.