DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab-6.2

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_510790.1 Gene:rab-6.2 / 181759 WormBaseID:WBGene00004270 Length:205 Species:Caenorhabditis elegans


Alignment Length:188 Identity:80/188 - (42%)
Similarity:116/188 - (61%) Gaps:10/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            :||||.|||.:|||:||:.||:...|....::|||..||::|:.:||..|:.::||||||||:.|
 Worm    10 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRS 74

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAK 158
            |.|.|.|.:..|:|||||.|.:||.:...|:.::..:...:::|.|.|||.|||:.|.|..||.:
 Worm    75 LIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVTTDEGE 139

  Fly   159 QYAEENGLLFMETSAKTGMNVNDIFLAIAKKLP---KNDGANNQGTSIRPTGTETNRP 213
            :.|:|..::|:|||||.|.||..:|..||..||   |:|       .:.|....|..|
 Worm   140 RKAKELNVMFIETSAKAGYNVKQLFRRIAGALPGIIKDD-------PVEPPNVVTMDP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 73/161 (45%)
rab-6.2NP_510790.1 Rab6 11..171 CDD:206654 73/159 (46%)
RAB 11..168 CDD:197555 71/156 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.