Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497608.1 | Gene: | Y71H2AM.12 / 175389 | WormBaseID: | WBGene00022177 | Length: | 195 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 60/197 - (30%) |
---|---|---|---|
Similarity: | 101/197 - (51%) | Gaps: | 19/197 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIED-TVVKFEIWDTAGQERYHSL 94
Fly 95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159
Fly 160 YA--EENGLLFMETSAKTGMNVNDIFLAIA-KKLPKNDGAN----NQGTSIRPTGTETNRPTNNC 217
Fly 218 CK 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 52/163 (32%) |
Y71H2AM.12 | NP_497608.1 | Ras | 13..163 | CDD:278499 | 49/153 (32%) |
Rab | 13..163 | CDD:206640 | 49/153 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |