DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Y71H2AM.12

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_497608.1 Gene:Y71H2AM.12 / 175389 WormBaseID:WBGene00022177 Length:195 Species:Caenorhabditis elegans


Alignment Length:197 Identity:60/197 - (30%)
Similarity:101/197 - (51%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIED-TVVKFEIWDTAGQERYHSL 94
            |:|::|||..||::|:..|:...|.....:|||..|..:.:.:.| ..::.::||||||||:..|
 Worm     8 KVVVVGESGAGKTALLTCFLDNTFETDPLTTIGIDFKHKIVQLNDGQSIRLQLWDTAGQERFRQL 72

  Fly    95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159
            ||.|.|.|:.|::|.|:.:::..:....|...:.|..|......:.|||.||    |.|....:.
 Worm    73 APAYIRSARVALLVIDLSDENCVEHLIRWKGIIDKNKSDFTSTIIVGNKHDL----VSEKRSPRL 133

  Fly   160 YA--EENGLLFMETSAKTGMNVNDIFLAIA-KKLPKNDGAN----NQGTSIRPTGTETNRPTNNC 217
            .|  .|....::|||||...|:..:|.::| :..|:::.:.    |:.   ||..:.|.|    |
 Worm   134 TAIIRETNDEYIETSAKMRKNIKKLFSSVACRPFPEHETSQIILLNEP---RPVESATKR----C 191

  Fly   218 CK 219
            |:
 Worm   192 CQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 52/163 (32%)
Y71H2AM.12NP_497608.1 Ras 13..163 CDD:278499 49/153 (32%)
Rab 13..163 CDD:206640 49/153 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.