DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and AgaP_AGAP002991

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_311898.4 Gene:AgaP_AGAP002991 / 1272967 VectorBaseID:AGAP002991 Length:393 Species:Anopheles gambiae


Alignment Length:167 Identity:39/167 - (23%)
Similarity:67/167 - (40%) Gaps:59/167 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ-------TICIEDTVVKF------EI 82
            |::|:|:|..||:|:             .|.|.|.::.:       ||.:|.:.|:|      .:
Mosquito     4 KVLLMGKSGSGKTSM-------------RSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNL 55

  Fly    83 WDTAGQER-----YHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQA---------SP 133
            ||..|||.     :.|.....:|..:..|.|:|:::::       ..|::|...         ||
Mosquito    56 WDCGGQESFMEQYFASQKDNIFRNVEVLIYVFDVESRE-------LDKDMHYYQSCLEALLVNSP 113

  Fly   134 NIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFME 170
            |..|....:|.||    |.|        |:..::|.|
Mosquito   114 NAKIFCLVHKMDL----VAE--------EQRDIIFKE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 39/167 (23%)
AgaP_AGAP002991XP_311898.4 RagA_like 4..287 CDD:206744 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.