DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and AgaP_AGAP011306

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_309343.4 Gene:AgaP_AGAP011306 / 1270628 VectorBaseID:AGAP011306 Length:278 Species:Anopheles gambiae


Alignment Length:207 Identity:60/207 - (28%)
Similarity:98/207 - (47%) Gaps:41/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TAQRP--------NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFH-EYQES---------T 61
            |.:||        :..|.|.:.:.|:|::|.:.||||||:.:|:...|. :|:.:         :
Mosquito    22 TEERPKREKPLKNDENSINSNVRHKIVMMGAAKVGKSSLITQFLYSSFSPKYKRTVEEMHHGHFS 86

  Fly    62 IGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKE 126
            :|...||           .:|.||:|...:.::..:....|.|.|:|||:.:..:|:..|...::
Mosquito    87 VGGVNLT-----------LDILDTSGSYEFPAMRALSISSADAFILVYDVTDSITFEEVKAIREQ 140

  Fly   127 LHKQASPNIV-IALAGNKADLS----NIRVVEFDEAKQYAE---ENGLLFMETSAKTGMNVNDIF 183
            :|:..|...| |.:.|||.|||    ::|.|..|..:....   |||  |:|.|||...||..||
Mosquito   141 IHEIKSTTAVPIVVVGNKTDLSDEDEDLRQVPRDTTESMVTVDWENG--FVEASAKLNRNVTQIF 203

  Fly   184 --LAIAKKLPKN 193
              |.:..|:..|
Mosquito   204 KELLVQAKITYN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 54/181 (30%)
AgaP_AGAP011306XP_309343.4 small_GTPase 45..212 CDD:197466 53/179 (30%)
P-loop_NTPase 46..278 CDD:304359 55/183 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.