DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAB31

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_016881017.1 Gene:RAB31 / 11031 HGNCID:9771 Length:248 Species:Homo sapiens


Alignment Length:225 Identity:99/225 - (44%)
Similarity:138/225 - (61%) Gaps:13/225 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SGGASGTG-----TAQ--RPNGTSQNK--SC---QFKL-VLLGESAVGKSSLVLRFVKGQFHEYQ 58
            |.|..||.     .:|  :.:|..|.:  ||   ::|: |...::.|||||:|.|||:..|....
Human    24 SRGTDGTDLFPYEVSQYWQDSGQGQGRLHSCGTTRWKMEVCSQDTGVGKSSIVCRFVQDHFDHNI 88

  Fly    59 ESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTW 123
            ..||||:|:|:|:...:.:.||.|||||||||:||||||||||:.||::||||..||||...|.|
Human    89 SPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKW 153

  Fly   124 VKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAK 188
            ||||.:....|||:|:||||.|||:||.|...:||:|||..|.:.:|||||..:|:.::|..|::
Human   154 VKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISR 218

  Fly   189 KLPKNDGANNQGTSIRPTGTETNRPTNNCC 218
            ::|..|...|...........|.:.:..||
Human   219 QIPPLDPHENGNNGTIKVEKPTMQASRRCC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 84/162 (52%)
RAB31XP_016881017.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.