DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RRAGB

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_057740.2 Gene:RRAGB / 10325 HGNCID:19901 Length:374 Species:Homo sapiens


Alignment Length:188 Identity:40/188 - (21%)
Similarity:75/188 - (39%) Gaps:61/188 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NKSCQFKLVLLGESAVGKSSL--------VLR-------FVKGQFHEYQ-------ESTIGAAFL 67
            |.:.:.|::|:|:|..||:|:        :.|       .:..:.|..|       .|.:.:...
Human    36 NTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGN 100

  Fly    68 TQTICIEDTVVKF------EIWDTAGQER-----YHSLAPMYYRGAQAAIVVYDIQNQDSFQRAK 121
            |:|..:|.:.|:|      .:||..||:.     :.|.....:|..:..|.|:|:::::      
Human   101 TKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRE------ 159

  Fly   122 TWVKELH---------KQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFME 170
             ..|::|         .|.||:..|....:|.||    |.|        ::..|:|.|
Human   160 -LEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDL----VQE--------DQRDLIFKE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 39/184 (21%)
RRAGBNP_057740.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
RagA_like 42..353 CDD:206744 39/182 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.