DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab37

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_008766630.1 Gene:Rab37 / 100364984 RGDID:2319982 Length:223 Species:Rattus norvegicus


Alignment Length:223 Identity:90/223 - (40%)
Similarity:131/223 - (58%) Gaps:8/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATTPRSGGASGTGTAQRPNGT---SQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQ-EST 61
            |..||   ||:..|..:.|..:   |.|.....|::|||:|.|||:..:::|..|.|.... .:|
  Rat     1 MTGTP---GAATAGDGEAPERSPPFSPNYDLTGKVMLLGDSGVGKTCFLIQFKDGAFLSGTFIAT 62

  Fly    62 IGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKE 126
            :|..|..:.:.::...||.:|||||||||:.|:...|||.|||.:::|||.||.||...:.|:.|
  Rat    63 VGIDFRNKVVTVDGARVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNQSSFDNIRAWLTE 127

  Fly   127 LHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLP 191
            :|:.|..::||.|.|||||:|:.||:..::.:..|.|.|:.||||||||||||...||||||:|.
  Rat   128 IHEYAQRDVVIMLLGNKADVSSERVIRSEDGETLAREYGVPFMETSAKTGMNVELAFLAIAKELK 192

  Fly   192 KNDGANNQGTSIRPTG-TETNRPTNNCC 218
            ...|......|.:... .|:.:..::||
  Rat   193 YRAGKQPDEPSFQIRDYVESQKKRSSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 75/162 (46%)
Rab37XP_008766630.1 Rab26 31..220 CDD:206695 79/188 (42%)
RAB 31..192 CDD:197555 75/160 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.