DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab5al1

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_003751425.1 Gene:Rab5al1 / 100361891 RGDID:2319287 Length:215 Species:Rattus norvegicus


Alignment Length:208 Identity:154/208 - (74%)
Similarity:173/208 - (83%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQRPNG-TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVK 79
            |.|||| .:.||.|||||||||||||||||||||||||||||:|||||||||||||:|::||.||
  Rat     6 ATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK 70

  Fly    80 FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKA 144
            ||||||||||||||||||||||||||||||||.|::||.|||.|||||.:||||||||||:||||
  Rat    71 FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFSRAKNWVKELQRQASPNIVIALSGNKA 135

  Fly   145 DLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTE 209
            ||:|.|.|:|.||:.||::|.||||||||||.||||:||:|||||||||:..|....|.|..|.:
  Rat   136 DLANKRAVDFQEAQSYADDNSLLFMETSAKTPMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVD 200

  Fly   210 TNRPT----NNCC 218
            ...|.    :.||
  Rat   201 LTEPAQPARSQCC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 135/161 (84%)
Rab5al1XP_003751425.1 Rab5_related 20..182 CDD:206653 135/161 (84%)
Ras 22..183 CDD:278499 134/160 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1654
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 308 1.000 Inparanoid score I2540
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm45820
orthoMCL 1 0.900 - - OOG6_100743
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X457
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.