DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab31

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001093711.1 Gene:rab31 / 100101725 XenbaseID:XB-GENE-489298 Length:194 Species:Xenopus tropicalis


Alignment Length:190 Identity:91/190 - (47%)
Similarity:127/190 - (66%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            :.|:.|||::.|||||:|.|||:..|......||||:|:|:|:...:.:.||.|||||||||:||
 Frog     5 ELKVCLLGDTGVGKSSIVSRFVQDHFDHNISPTIGASFMTKTVPSGNELHKFLIWDTAGQERFHS 69

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAK 158
            ||||||||:.||::||||..||:|...|.|||||.:....|||:|:||||.|||:.|.|...:|:
 Frog    70 LAPMYYRGSAAAVIVYDITKQDTFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDTREVTMKDAR 134

  Fly   159 QYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTETNRPTNNCC 218
            :|||..|.:.:|||||..:||.::|..|::::|..|...|........|.::.:.|..||
 Frog   135 EYAESIGAIVVETSAKNAINVEELFQGISRRIPPLDPHENGSNGAMKLGRQSFQSTTRCC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 84/161 (52%)
rab31NP_001093711.1 Rab5_related 5..167 CDD:206653 84/161 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.