DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab22a

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_991282.2 Gene:rab22a / 100001531 ZFINID:ZDB-GENE-041114-161 Length:196 Species:Danio rerio


Alignment Length:193 Identity:92/193 - (47%)
Similarity:132/193 - (68%) Gaps:4/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            :.|:.|||::.|||||:|.|||:..|......||||:|:|:|:..::.:.||.|||||||||:.:
Zfish     5 ELKVCLLGDTGVGKSSIVCRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRA 69

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAK 158
            ||||||||:.|||:||||..::|||..|.|||||.:...||||:|:||||.|||:.|.|...:||
Zfish    70 LAPMYYRGSAAAIIVYDITKEESFQTLKNWVKELRQHGPPNIVVAIAGNKCDLSDAREVSEKDAK 134

  Fly   159 QYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND---GANNQGTSIRPTGTETNRPTNNCC 218
            .||:....:|:|||||..:|:|::|..|::::|..|   |:..:|..:|...:.:.| ...||
Zfish   135 DYADSIHAIFIETSAKNAININEVFTQISERIPVLDAEGGSAVKGFKLRRQPSVSTR-ERTCC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 84/161 (52%)
rab22aNP_991282.2 Rab5_related 5..167 CDD:206653 84/161 (52%)
RAB 6..166 CDD:197555 84/159 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.