DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9967 and Mkrn2os

DIOPT Version :9

Sequence 1:NP_001014461.1 Gene:CG9967 / 33414 FlyBaseID:FBgn0031413 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001094901.1 Gene:Mkrn2os / 70291 MGIID:1917541 Length:217 Species:Mus musculus


Alignment Length:242 Identity:75/242 - (30%)
Similarity:112/242 - (46%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILCFHHCNVKVFCFTLPHTCPHCNAPLDADVDAHGDVDGDADPSAQLDRAGPRLLLLPFRLPYPF 80
            ::.|.||...::.|::|..||.|          .|||.     |.:::.|       |..:..||
Mouse    10 LIKFRHCERSIYTFSVPQCCPLC----------QGDVG-----STRIEDA-------PISISDPF 52

  Fly    81 VRATQHPCAIVLRPSAGDFLNDYSNATDLHIAVTTSGGDIVEFDRFGLRRHRRDDNPPEWRQSLM 145
            ....|..||.:|:|:.|.||.:|...:|||:.:|.:.|.:..:...|::|     :...|.:||.
Mouse    53 SNGHQEKCAFLLKPTRGTFLREYDGKSDLHVGITNTRGVVYNYSARGIQR-----DEAGWERSLS 112

  Fly   146 VGDVPEPWH---DFWDEVLQQICAQSVRWSIASYAEESHNCYAFVLAFLQAL----GHAHLSEAA 203
            |..|.....   |.||:.|:...| |:.|....|.|..|||..|.|||:..:    |...|    
Mouse   113 VPLVQPSMFGLLDQWDKYLEDFSA-SLAWLPHRYEENQHNCLTFALAFINCILAMEGREQL---- 172

  Fly   204 RSKTAFCEQCIVPRTTTAGKYISLYRKIRRSGIYVHRQQPKNRSKPA 250
             .|.||.|:.::|||..|.|||.|:|.|:.||.:| ...|..|:.|:
Mouse   173 -DKHAFTEKYVIPRTRLASKYIMLFRAIQESGFHV-TDHPDPRTSPS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9967NP_001014461.1 DUF4796 14..231 CDD:292663 68/221 (31%)
Mkrn2osNP_001094901.1 DUF4796 8..199 CDD:292663 68/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6619
eggNOG 1 0.900 - - E1_2CJJG
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H66298
Inparanoid 1 1.050 114 1.000 Inparanoid score I4833
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49162
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005520
OrthoInspector 1 1.000 - - oto93856
orthoMCL 1 0.900 - - OOG6_109257
Panther 1 1.100 - - LDO PTHR33963
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3047
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.