powered by:
Protein Alignment CG9967 and W10D9.6
DIOPT Version :9
Sequence 1: | NP_001014461.1 |
Gene: | CG9967 / 33414 |
FlyBaseID: | FBgn0031413 |
Length: | 298 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254012.1 |
Gene: | W10D9.6 / 13183306 |
WormBaseID: | WBGene00185079 |
Length: | 178 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 25/71 - (35%) |
Gaps: | 29/71 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 DFLNDYSNATDLHIAVTTSGGDIVEFDRFGLRRHRRDDNPPEWRQSLMVGDVPEPWHDFWDEVLQ 162
|||.| |...|.:|..|....| :|::| .||:.::...
Worm 3 DFLED-SEQNDRNICQTDFLAD--QFEKF--------------------------THDYREKTEP 38
Fly 163 QICAQS 168
:.||::
Worm 39 KCCAET 44
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9967 | NP_001014461.1 |
DUF4796 |
14..231 |
CDD:292663 |
15/71 (21%) |
W10D9.6 | NP_001254012.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR33963 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.