DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9967 and W10D9.6

DIOPT Version :9

Sequence 1:NP_001014461.1 Gene:CG9967 / 33414 FlyBaseID:FBgn0031413 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001254012.1 Gene:W10D9.6 / 13183306 WormBaseID:WBGene00185079 Length:178 Species:Caenorhabditis elegans


Alignment Length:71 Identity:15/71 - (21%)
Similarity:25/71 - (35%) Gaps:29/71 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DFLNDYSNATDLHIAVTTSGGDIVEFDRFGLRRHRRDDNPPEWRQSLMVGDVPEPWHDFWDEVLQ 162
            |||.| |...|.:|..|....|  :|::|                          .||:.::...
 Worm     3 DFLED-SEQNDRNICQTDFLAD--QFEKF--------------------------THDYREKTEP 38

  Fly   163 QICAQS 168
            :.||::
 Worm    39 KCCAET 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9967NP_001014461.1 DUF4796 14..231 CDD:292663 15/71 (21%)
W10D9.6NP_001254012.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33963
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.