DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9967 and mkrn2os.2

DIOPT Version :9

Sequence 1:NP_001014461.1 Gene:CG9967 / 33414 FlyBaseID:FBgn0031413 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_001920208.5 Gene:mkrn2os.2 / 100150803 ZFINID:ZDB-GENE-160114-87 Length:221 Species:Danio rerio


Alignment Length:239 Identity:62/239 - (25%)
Similarity:103/239 - (43%) Gaps:36/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DPGILCFHHCNVKVFCFTLPHTCPHCNAPLDADVDAHGDVDGDADPSAQLDRAGPRLLLLPFRLP 77
            :..::.|.||:..:|||.:|..||.|...|                      :|.||...|..:|
Zfish     2 EKSVIKFSHCHRDIFCFFVPDQCPECGESL----------------------SGKRLEEAPVSIP 44

  Fly    78 YPFVRATQHPCAIVLRPSAGDFLNDYSNATDLHIAVTTSGGDIVEFDRFGLRRHRRDDNPPEWRQ 142
            .||....:.|||.::..:....|.|:...:|||..:|.:.|.:..:...|::|..:.     |.:
Zfish    45 NPFSNGHKTPCAFLVASAEDRLLRDFDGQSDLHTGITNTNGVVYNYTCAGVQRETQG-----WER 104

  Fly   143 SLMVGDVPEPWHDF---WDEVLQQICAQSV---RWSIASYAEESHNCYAFVLAFLQALGHAHLSE 201
            .:.|..|.......   ||:.|::.....:   .|.  |:.||||||::|.|.|:..: .|..|:
Zfish   105 CICVPLVQPDMFSLISQWDQYLEKFSTAQMWDPLWQ--SFNEESHNCFSFTLMFINCV-LATQSK 166

  Fly   202 AARSKTAFCEQCIVPRTTTAGKYISLYRKIRRSGIYVHRQQPKN 245
            .|.||..|....::||...|.||:.|..:|.::..|:.....:|
Zfish   167 RALSKDEFTHSFVLPRIKRASKYMMLCSQITQNHFYIVNNPRRN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9967NP_001014461.1 DUF4796 14..231 CDD:292663 59/222 (27%)
mkrn2os.2XP_001920208.5 DUF4796 3..196 CDD:292663 59/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7604
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H66298
Inparanoid 1 1.050 96 1.000 Inparanoid score I5041
OMA 1 1.010 - - QHG49162
OrthoDB 1 1.010 - - D1134473at2759
OrthoFinder 1 1.000 - - FOG0005520
OrthoInspector 1 1.000 - - otm25411
orthoMCL 1 0.900 - - OOG6_109257
Panther 1 1.100 - - LDO PTHR33963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.