DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9967 and mkrn2os.1

DIOPT Version :9

Sequence 1:NP_001014461.1 Gene:CG9967 / 33414 FlyBaseID:FBgn0031413 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001373593.1 Gene:mkrn2os.1 / 100149633 ZFINID:ZDB-GENE-160114-86 Length:222 Species:Danio rerio


Alignment Length:242 Identity:55/242 - (22%)
Similarity:97/242 - (40%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILCFHHCNVKVFCFTLPH------------TCPHCNAPLDADVDAHGDVDGDADPSAQLDRAGPR 68
            ::.:.||...::.|:.|:            .||.|                     .|:...|  
Zfish     5 VIKYIHCGRSIYSFSCPNGGYSERPGGAARQCPIC---------------------LQILTFG-- 46

  Fly    69 LLLLPFRLPYPFVRATQHPCAIVLRPSAG-DFLNDYSNATDLHIAVTTSGGDIVEFDRFGLRRHR 132
            ||..|..:|.|.....|..||.::..:.| ..|.::.: :::|:.::.|.|.:..:...|::|..
Zfish    47 LLDAPVCVPCPLRNGHQVSCAFLIGSAHGPSHLGEWQD-SEIHVGLSDSAGLVYNYTLSGVQRDD 110

  Fly   133 RDDNPPEWRQSLMVGDVP---EPWHDFWDEVLQQICAQSVRWSIASYAEE---SHNCYAFVLAFL 191
            |.     |.|.:.|..||   ....:.||..| |:.|....|:...:.||   ...||.|.|.|:
Zfish   111 RG-----WEQCVCVQLVPPSRPELRELWDTHL-QLFALLPEWASERFEEEREFGSCCYGFALTFI 169

  Fly   192 QALGHAHLSEAARSKTAFCEQCIVPRTTTAGKYISLYRKIRRSGIYV 238
            ..:.... ::...|:..|..:.|:||..|...|||:|:.|.:.|.::
Zfish   170 NRMRSLD-NKDCLSRDEFTGRYILPRMKTVSLYISIYQTILQHGFHI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9967NP_001014461.1 DUF4796 14..231 CDD:292663 53/233 (23%)
mkrn2os.1NP_001373593.1 DUF4796 3..208 CDD:406452 53/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7604
eggNOG 1 0.900 - - E1_2CJJG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5041
OMA 1 1.010 - - QHG49162
OrthoDB 1 1.010 - - D1134473at2759
OrthoFinder 1 1.000 - - FOG0005520
OrthoInspector 1 1.000 - - otm25411
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33963
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3047
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.