DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9967 and MKRN2OS

DIOPT Version :9

Sequence 1:NP_001014461.1 Gene:CG9967 / 33414 FlyBaseID:FBgn0031413 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001182208.1 Gene:MKRN2OS / 100129480 HGNCID:40375 Length:223 Species:Homo sapiens


Alignment Length:246 Identity:71/246 - (28%)
Similarity:112/246 - (45%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILCFHHCNVKVFCFTLPHTCPHCNAPLDADVDAHGDVDGDADPSAQLDRAGPRLLLLPFRLPYPF 80
            ::.|:||...::.|::|..||.|...|.               |.:|:.|       |..:..||
Human    10 LIKFNHCEKYIYSFSVPQCCPLCQQDLG---------------SRKLEDA-------PVSIANPF 52

  Fly    81 VRATQHPCAIVLRPSAGDFLNDYSNATDLHIAVTTSGGDIVEFDRFGLRRHRRDDNPPEWRQSL- 144
            ....|..|:.:|||:.|.||.:|...:|||:.:|.:.|.:..:...|::|     :...|.:|: 
Human    53 TNGHQEKCSFLLRPTQGTFLREYDGRSDLHVGITNTNGVVYNYSAHGVQR-----DGEGWEESIS 112

  Fly   145 -------MVGDVPEPWHDFWDEVLQQICAQSVRWSIASYAEESHNCYAFVLAF----LQALGHAH 198
                   |.|.:.:     ||:.|:.. :.|..|....|.:..||||::.|.|    |.|.|...
Human   113 IPLLQPNMYGMMEQ-----WDKYLEDF-STSGAWLPHRYEDNHHNCYSYALTFINCVLMAEGRQQ 171

  Fly   199 LSEAARSKTAFCEQCIVPRTTTAGKYISLYRKIRRSGIYVHRQQPKNRSKP 249
            |     .|..|.|:.:||||..|.|:|:|||.||..|.|| ...|:.:::|
Human   172 L-----DKGEFTEKYVVPRTRLASKFITLYRAIREHGFYV-TDCPQQQAQP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9967NP_001014461.1 DUF4796 14..231 CDD:292663 64/226 (28%)
MKRN2OSNP_001182208.1 DUF4796 8..199 CDD:292663 64/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I7064
eggNOG 1 0.900 - - E1_2CJJG
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H66298
Inparanoid 1 1.050 109 1.000 Inparanoid score I4912
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49162
OrthoDB 1 1.010 - - D1134473at2759
OrthoFinder 1 1.000 - - FOG0005520
OrthoInspector 1 1.000 - - oto90274
orthoMCL 1 0.900 - - OOG6_109257
Panther 1 1.100 - - LDO PTHR33963
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3047
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.