DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and PRY2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:53/147 - (36%)
Similarity:76/147 - (51%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAQQFEQEVLQAHNLYRAKH-GAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG--YGENIYM 63
            |:..|...::..||..||.| ....||.|   :.|||...||..|.:...:..:||  ||||:.:
Yeast   188 SSSDFSTSMVNEHNTKRALHKDTGSLTWS---DTLATYAQNYADSYDCSGNLVHSGGPYGENLAL 249

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGST--IYVVCN 126
            ..|    ...:|.:||.||..|::::|.|..:.|||||||||.::|:|.|....|..  .|::|:
Yeast   250 GYG----TTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310

  Fly   127 YNPPGNYNNLFRENVAP 143
            |...||....|.:||.|
Yeast   311 YKAAGNVIGEFADNVMP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 44/124 (35%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 48/134 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I1908
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H116686
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm46540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.