DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and PRY3

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:63/144 - (43%)
Similarity:83/144 - (57%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FEQEVLQAHNLYRAKH-GAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENI---YMASG 66
            ||.:||..||.:||.| ...|||.|..|...|..:|:.......:.| .:..||||:   |..:|
Yeast    25 FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTH-SDGPYGENLALGYTDTG 88

  Fly    67 GNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGST--IYVVCNYNP 129
                   ||.:||.||.:||:::|.|..:|||||||||||:.|:|.|:...|:|  .|:||:|||
Yeast    89 -------AVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNP 146

  Fly   130 PGNYNNLFRENVAP 143
            ||||...|.|.|.|
Yeast   147 PGNYLGEFAEEVEP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 50/124 (40%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 59/134 (44%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I1908
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.