DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and AT5G26130

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_197985.2 Gene:AT5G26130 / 832682 AraportID:AT5G26130 Length:166 Species:Arabidopsis thaliana


Alignment Length:142 Identity:55/142 - (38%)
Similarity:76/142 - (53%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWA-NYLLSRN---RMEHRQNSG-YGEN 60
            :.||...|:.|..||..|.:.|..|:    |.:..|.::| ||...|.   .:.|..::| ||||
plant    25 LKAQDQPQDYLDEHNRARTQVGVPPM----KWHAGAEQYAWNYAQQRKGDCSLTHSNSNGLYGEN 85

  Fly    61 IYMASGGNLKGADAVRSWYEEIRQYNW--NSPSFQGNTGHFTQVVWKSSTELGVGFAK--SGSTI 121
            :.. |||.|.||:||:.|..|...|.:  |:.|.....||:|||||::|..:|....|  :|.| 
plant    86 LAW-SGGALSGAEAVKLWVNEKSDYIYASNTCSDGKQCGHYTQVVWRTSEWVGCAKVKCDNGGT- 148

  Fly   122 YVVCNYNPPGNY 133
            :|.|||.|||||
plant   149 FVTCNYYPPGNY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 45/128 (35%)
AT5G26130NP_197985.2 CAP_PR-1 31..166 CDD:349400 53/136 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.