DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and AT4G33730

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:136 Identity:55/136 - (40%)
Similarity:78/136 - (57%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRN-RMEHRQNSG-YGENIYMAS 65
            :.::....|:.||..||....:||.....:..:|.::||:|.|.. .:||  :|| ||||:...|
plant    35 SHEYPDSYLRPHNAARAAVKVKPLRWDFGIATVAQDYANHLASGPCSLEH--SSGPYGENLAFGS 97

  Fly    66 GGNLKGADAVRSWYEEIRQYNWNSPSFQGNT-GHFTQVVWKSSTELGVGFAK--SGSTIYVVCNY 127
             |::..|.||..|..|...|::.|.|..|.. ||:|||||:.|..||.|.||  :|::| |||||
plant    98 -GDMSAAQAVAMWVHEKSYYDFYSNSCHGPACGHYTQVVWRGSARLGCGKAKCNNGASI-VVCNY 160

  Fly   128 NPPGNY 133
            :|.|||
plant   161 DPAGNY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 47/124 (38%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 55/132 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.