DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and AT4G33710

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_195097.1 Gene:AT4G33710 / 829513 AraportID:AT4G33710 Length:166 Species:Arabidopsis thaliana


Alignment Length:142 Identity:51/142 - (35%)
Similarity:72/142 - (50%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQQFEQEVLQAHNLYRAKHGAQPLTLSP-KLNRLATEWA-NYLLSRN---RMEHRQNSG-YGE 59
            :.||...|:.|..||     |....:::.. |.:..|..:| ||...|.   |:.|..:.| |||
plant    25 LKAQDRRQDYLDVHN-----HARDDVSVPHIKWHAGAARYAWNYAQRRKRDCRLIHSNSRGRYGE 84

  Fly    60 NIYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQG--NTGHFTQVVWKSSTELGVGFAK--SGST 120
            |:..:| |::.||.|||.|..|...|...|.:.:.  ..||:||||||:|..:|....|  :|.|
plant    85 NLAWSS-GDMSGAAAVRLWVREKSDYFHKSNTCRAGKQCGHYTQVVWKNSEWVGCAKVKCDNGGT 148

  Fly   121 IYVVCNYNPPGN 132
             :|.|||:.|||
plant   149 -FVTCNYSHPGN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 43/129 (33%)
AT4G33710NP_195097.1 CAP_PR-1 32..166 CDD:349400 49/135 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.