DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and AT4G31470

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:138 Identity:49/138 - (35%)
Similarity:76/138 - (55%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG--YGENIYM 63
            ::....:|:.|:.||:.|||....||..|..|...|:.||.......::.|   ||  ||||::.
plant    45 LARNTIQQQFLRPHNILRAKLRLPPLKWSNSLALYASRWARTRRGDCKLIH---SGGPYGENLFW 106

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTG--HFTQVVWKSSTELG--VGFAKSGSTIYVV 124
            .||......|||.:|..|::.|:..:...:.|..  |:||:|||.|:.:|  :.|.|:|.| :::
plant   107 GSGKGWTPRDAVAAWASEMKYYDRRTSHCKANGDCLHYTQLVWKKSSRIGCAISFCKTGDT-FII 170

  Fly   125 CNYNPPGN 132
            |||:||||
plant   171 CNYDPPGN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 42/125 (34%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 49/132 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101367
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.730

Return to query results.
Submit another query.