DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and AT3G09590

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:141 Identity:49/141 - (34%)
Similarity:67/141 - (47%) Gaps:20/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG--YGENIYMASGG 67
            :..:|.|||||..|...|...|.....|.|.|.:||....|...|.|   ||  |||||:.....
plant    48 KLSREFLQAHNDARVSSGVPTLGWDRDLARFADKWAKQRKSDCSMIH---SGGPYGENIFWHRRK 109

  Fly    68 NLKGAD-AVRSWYEEIRQYNWNSPSFQGNT-------GHFTQVVWKSSTELGVGFAK--SGSTIY 122
            .....: .|..|:||  ::|::   .:.||       ||:||:||:.:|.:|....|  :|....
plant   110 KTWSPEKVVTRWFEE--RFNYD---VKTNTCAPGKMCGHYTQMVWRETTAVGCARVKCHNGRGYL 169

  Fly   123 VVCNYNPPGNY 133
            |||.|:|.|||
plant   170 VVCEYDPRGNY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 42/131 (32%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 49/139 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.